PLA2G4E Peptide - C-terminal region

Catalog Number: BYT-ORB2009509
Article Name: PLA2G4E Peptide - C-terminal region
Biozol Catalog Number: BYT-ORB2009509
Supplier Catalog Number: orb2009509
Alternative Catalog Number: BYT-ORB2009509-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: FLJ45651, MGC126633, MGC126661
PLA2G4E Peptide - C-terminal region
Molecular Weight: 96kDa
NCBI: 001073959
UniProt: C9JK77
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: TFFPLINDTFRKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEAT
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PLA2G4E Rabbit Polyclonal Antibody (orb582115). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings