PKN2 Peptide - C-terminal region

Product Overview

• Article Name: PKN2 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2009511
• Supplier Catalog Number: orb2009511
• Alternative Catalog Number: BYT-ORB2009511-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: MGC150606, MGC71074, PAK2, PRK2, PRKCL2, PRO2042, Pak-2

Product Description

PKN2 Peptide - C-terminal region

Product Properties

• Molecular Weight: 108kDa
• NCBI: 006247
• UniProt: Q16513
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: TVFDIQNDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNL

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PKN2 Rabbit Polyclonal Antibody (orb585152). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings