Pja2 Peptide - N-terminal region

Catalog Number: BYT-ORB2009516
Article Name: Pja2 Peptide - N-terminal region
Biozol Catalog Number: BYT-ORB2009516
Supplier Catalog Number: orb2009516
Alternative Catalog Number: BYT-ORB2009516-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: AI447901, AL022700, MGC27629, Neurodap1, mKIAA0438
Pja2 Peptide - N-terminal region
Molecular Weight: 71kDa
NCBI: 659108
UniProt: Q80U04
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: PAGGYQTITGRRYGRRHAYVSFKPCMTRHERSLGRAGDDYEVLELDDVPK
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with Pja2 Rabbit Polyclonal Antibody (orb578747). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings