PITX2 Peptide - N-terminal region

Product Overview

• Article Name: PITX2 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2009518
• Supplier Catalog Number: orb2009518
• Alternative Catalog Number: BYT-ORB2009518-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: ARP1, Brx1, IDG2, IGDS, IGDS2, IHG2, IRID2, MGC111022, MGC20144, Otlx2, PTX2, RGS, RIEG, RIEG1, RS

Product Description

PITX2 Peptide - N-terminal region

Product Properties

• Molecular Weight: 36kDa
• NCBI: 000316
• UniProt: Q99697
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: EHRAAGTKLSAVSSSSCHHPQPLAMASVLAPGQPRSLDSSKHRLEVHTIS

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PITX2 Rabbit Polyclonal Antibody (orb576481). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings