PITPNM1 Peptide - N-terminal region

Product Overview

• Article Name: PITPNM1 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2009521
• Supplier Catalog Number: orb2009521
• Alternative Catalog Number: BYT-ORB2009521-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: DRES9, FLJ44997, NIR2, PITPNM, RDGB, RDGB1, RDGBA, RDGBA1, Rd9

Product Description

PITPNM1 Peptide - N-terminal region

Product Properties

• Molecular Weight: 135kDa
• NCBI: 001124320
• UniProt: O35954
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: PDGGQQPNVFNLSGAERRQRIVDTIDIVRDAVAPGEYKAEEDPRLYRSAK

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PITPNM1 Rabbit Polyclonal Antibody (orb584455). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings