PIP5KL1 Peptide - C-terminal region

Product Overview

• Article Name: PIP5KL1 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2009522
• Supplier Catalog Number: orb2009522
• Alternative Catalog Number: BYT-ORB2009522-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: MGC46424, PIPKH, bA203J24.5, RP11-203J24.5

Product Description

PIP5KL1 Peptide - C-terminal region

Product Properties

• Molecular Weight: 43kDa
• NCBI: 001128691
• UniProt: Q5T9C9
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: LGPQRSWFLRQMELDTTFLRELNVLDYSLLIAFQRLHEDERGPGSSLIFR

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PIP5KL1 Rabbit Polyclonal Antibody (orb582004). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings