PIM2 Peptide - middle region

Catalog Number: BYT-ORB2009525
Article Name: PIM2 Peptide - middle region
Biozol Catalog Number: BYT-ORB2009525
Supplier Catalog Number: orb2009525
Alternative Catalog Number: BYT-ORB2009525-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
PIM2 Peptide - middle region
Molecular Weight: 34kDa
NCBI: 006866
UniProt: Q9P1W9
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: LRRGCAKLIDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVW
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PIM2 Rabbit Polyclonal Antibody (orb581645). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings