PIK3R5 Peptide - middle region

Product Overview

• Article Name: PIK3R5 Peptide - middle region
• Biozol Catalog Number: BYT-ORB2009526
• Supplier Catalog Number: orb2009526
• Alternative Catalog Number: BYT-ORB2009526-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: F730038I15Rik, FOAP-2, P101-PI3K, p101

Product Description

PIK3R5 Peptide - middle region

Product Properties

• Molecular Weight: 97kDa
• NCBI: 055123
• UniProt: Q8WYR1
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: SRAQRSRSLPQPKLGTQLPSWLLAPASRPQRRRPFLSGDEDPKASTLRVV

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PIK3R5 Rabbit Polyclonal Antibody (orb582587). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings