Pigw Peptide - middle region

Catalog Number: BYT-ORB2009529
Article Name: Pigw Peptide - middle region
Biozol Catalog Number: BYT-ORB2009529
Supplier Catalog Number: orb2009529
Alternative Catalog Number: BYT-ORB2009529-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: Pigw
Pigw Peptide - middle region
Molecular Weight: 55kDa
NCBI: 919443
UniProt: Q7TSN4
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: SIGYQEHSTEYGVHWNFFFTIIVVKLITSLLLIIFPLNKSWIVAISITVL
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with Pigw Rabbit Polyclonal Antibody (orb580660). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings