PIGQ Peptide - N-terminal region

Product Overview

• Article Name: PIGQ Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2009531
• Supplier Catalog Number: orb2009531
• Alternative Catalog Number: BYT-ORB2009531-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: GPI1, MGC12693, c407A10.1, hGPI1

Product Description

PIGQ Peptide - N-terminal region

Product Properties

• Molecular Weight: 84kDa
• NCBI: 683721
• UniProt: Q9BRB3
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: VLHFPFIPIQVKQLLAQVRQASQVGVAVLGTWCHCRQEPEESLGRFLESL

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PIGQ Rabbit Polyclonal Antibody (orb325271). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings