PIGL Peptide - N-terminal region

Catalog Number: BYT-ORB2009532
Article Name: PIGL Peptide - N-terminal region
Biozol Catalog Number: BYT-ORB2009532
Supplier Catalog Number: orb2009532
Alternative Catalog Number: BYT-ORB2009532-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: CHIME
PIGL Peptide - N-terminal region
Molecular Weight: 28kDa
NCBI: 004269
UniProt: Q9Y2B2
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: MEAMWLLCVALAVLAWGFLWVWDSSERMKSREQGGRLGAESRTLLVIAHP
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PIGL Rabbit Polyclonal Antibody (orb579786). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings