Pias2 Peptide - N-terminal region

Product Overview

• Article Name: Pias2 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2009535
• Supplier Catalog Number: orb2009535
• Alternative Catalog Number: BYT-ORB2009535-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: 6330408K17Rik, AI462206, ARIP3, AU018068, Dib, Miz1, PIASxalpha, PIASxb, PIASxbeta, SIZ2

Product Description

Pias2 Peptide - N-terminal region

Product Properties

• Molecular Weight: 63kDa
• NCBI: 001157639
• UniProt: Q8C5D8
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: PAVQIKIRELYRRRYPRTLEGLCDLSTIKSSVFSLDGSSSPVEPDLPVAG

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with Pias2 Rabbit Polyclonal Antibody (orb330731). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings