PI15 Peptide - N-terminal region

Catalog Number: BYT-ORB2009538
Article Name: PI15 Peptide - N-terminal region
Biozol Catalog Number: BYT-ORB2009538
Supplier Catalog Number: orb2009538
Alternative Catalog Number: BYT-ORB2009538-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: CRISP8, DKFZp686F0366, P24TI, P25TI
PI15 Peptide - N-terminal region
Molecular Weight: 23kDa
NCBI: 056970
UniProt: O43692
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: PPTNNFTDIEAALKAQLDSADIPKARRKRYISQNDMIAILDYHNQVRGKV
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PI15 Rabbit Polyclonal Antibody (orb584872). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings