PHYH Peptide - N-terminal region

Product Overview

• Article Name: PHYH Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2009540
• Supplier Catalog Number: orb2009540
• Alternative Catalog Number: BYT-ORB2009540-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: LN1, LNAP1, PAHX, PHYH1, RD

Product Description

PHYH Peptide - N-terminal region

Product Properties

• Molecular Weight: 26kDa
• NCBI: 001032626
• UniProt: O14832
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: TLPEILKYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYFPFR

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PHYH Rabbit Polyclonal Antibody (orb583261). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings