PHOX2A Peptide - C-terminal region

Product Overview

• Article Name: PHOX2A Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2009541
• Supplier Catalog Number: orb2009541
• Alternative Catalog Number: BYT-ORB2009541-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: ARIX, CFEOM2, FEOM2, MGC52227, NCAM2, PMX2A

Product Description

PHOX2A Peptide - C-terminal region

Product Properties

• Molecular Weight: 30kDa
• NCBI: 005160
• UniProt: O14813
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: VAGGGGGGPGAGAAELLKAWQPAESGPGPFSGVLSSFHRKPGPALKTNLF

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PHOX2A Rabbit Polyclonal Antibody (orb576743). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings