PARD6A Peptide - N-terminal region

Product Overview

• Article Name: PARD6A Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2009615
• Supplier Catalog Number: orb2009615
• Alternative Catalog Number: BYT-ORB2009615-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: PAR-6A, PAR6, PAR6C, PAR6alpha, TAX40, TIP-40

Product Description

PARD6A Peptide - N-terminal region

Product Properties

• Molecular Weight: 37kDa
• NCBI: 001032358
• UniProt: Q3TY70
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVH

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PARD6A Rabbit Polyclonal Antibody (orb578633). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings