Paqr4 Peptide - C-terminal region

Catalog Number: BYT-ORB2009616
Article Name: Paqr4 Peptide - C-terminal region
Biozol Catalog Number: BYT-ORB2009616
Supplier Catalog Number: orb2009616
Alternative Catalog Number: BYT-ORB2009616-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: MGC109357
Paqr4 Peptide - C-terminal region
Molecular Weight: 30kDa
NCBI: 001017377
UniProt: Q568Z3
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: ACRPWLRPAALMGYTALSGVAGWRALTAPSTSARLRAFGWQAGARLLVFG
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with Paqr4 Rabbit Polyclonal Antibody (orb325801). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings