TENT2 Peptide - C-terminal region

Catalog Number: BYT-ORB2009617
Article Name: TENT2 Peptide - C-terminal region
Biozol Catalog Number: BYT-ORB2009617
Supplier Catalog Number: orb2009617
Alternative Catalog Number: BYT-ORB2009617-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: Papd4
TENT2 Peptide - C-terminal region
Molecular Weight: 56kDa
NCBI: 001008373
UniProt: Q5U315
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: YICVEEPFDGTNTARAVHEKQKFDMIKDQFLKSWQRLKNKRDLNSVLPLR
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with TENT2 Rabbit Polyclonal Antibody (orb580649). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings