PALM Peptide - N-terminal region

Catalog Number: BYT-ORB2009618
Article Name: PALM Peptide - N-terminal region
Biozol Catalog Number: BYT-ORB2009618
Supplier Catalog Number: orb2009618
Alternative Catalog Number: BYT-ORB2009618-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: KIAA0270
PALM Peptide - N-terminal region
Molecular Weight: 37kDa
NCBI: 001035224
UniProt: O75781
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: LEDERRQLQHLKSKALRERWLLEGTPSSASEGDEDLRRQMQDDEQKTRLL
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PALM Rabbit Polyclonal Antibody (orb326088). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings