PAIP2 Peptide - N-terminal region

Catalog Number: BYT-ORB2009620
Article Name: PAIP2 Peptide - N-terminal region
Biozol Catalog Number: BYT-ORB2009620
Supplier Catalog Number: orb2009620
Alternative Catalog Number: BYT-ORB2009620-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: MGC72018, PAIP2A
PAIP2 Peptide - N-terminal region
Molecular Weight: 14kDa
NCBI: 057564
UniProt: Q9BPZ3
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: MKDPSRSSTSPSIINEDVIINGHSHEDDNPFAEYMWMENEEEFNRQIEEE
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PAIP2 Rabbit Polyclonal Antibody (orb583074). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings