PAGE4 Peptide - middle region

Product Overview

• Article Name: PAGE4 Peptide - middle region
• Biozol Catalog Number: BYT-ORB2009621
• Supplier Catalog Number: orb2009621
• Alternative Catalog Number: BYT-ORB2009621-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: FLJ35184, GAGE-9, GAGEC1, JM27, PAGE-1, PAGE-4, JM-27, CT16.7

Product Description

PAGE4 Peptide - middle region

Product Properties

• Molecular Weight: 11kDa
• NCBI: 008934
• UniProt: O60829
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: PPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQ

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PAGE4 Rabbit Polyclonal Antibody (orb578434). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings