PAF1 Peptide - N-terminal region

Catalog Number: BYT-ORB2009622
Article Name: PAF1 Peptide - N-terminal region
Biozol Catalog Number: BYT-ORB2009622
Supplier Catalog Number: orb2009622
Alternative Catalog Number: BYT-ORB2009622-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: F23149_1, FLJ11123, PD2
PAF1 Peptide - N-terminal region
Molecular Weight: 58kDa
NCBI: 061961
UniProt: Q8N7H5
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: IQAPTSSKRSQQHAKVVPWMRKTEYISTEFNRYGISNEKPEVKIGVSVKQ
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PAF1 Rabbit Polyclonal Antibody (orb585035). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings