PACS2 Peptide - middle region

Catalog Number: BYT-ORB2009624
Article Name: PACS2 Peptide - middle region
Biozol Catalog Number: BYT-ORB2009624
Supplier Catalog Number: orb2009624
Alternative Catalog Number: BYT-ORB2009624-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: FLJ25488, KIAA0602, PACS1L, PACS-2
PACS2 Peptide - middle region
Molecular Weight: 98kDa
NCBI: 056012
UniProt: Q86VP3
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: AHQLPIAEAMLTYKQKSPDEESSQKFIPFVGVVKVGIVEPSSATSGDSDD
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PACS2 Rabbit Polyclonal Antibody (orb581390). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings