Pa2g4 Peptide - C-terminal region

Catalog Number: BYT-ORB2009625
Article Name: Pa2g4 Peptide - C-terminal region
Biozol Catalog Number: BYT-ORB2009625
Supplier Catalog Number: orb2009625
Alternative Catalog Number: BYT-ORB2009625-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: 38kDa, AA672939, Ebp1, Plfap
Pa2g4 Peptide - C-terminal region
Molecular Weight: 44kDa
NCBI: 035249
UniProt: P50580
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: PDLYKSEMEVQDAELKALLQSSASRKTQKKKKKKASKTVENATSGETLEE
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with Pa2g4 Rabbit Polyclonal Antibody (orb583757). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings