P4HA1 Peptide - middle region

Catalog Number: BYT-ORB2009627
Article Name: P4HA1 Peptide - middle region
Biozol Catalog Number: BYT-ORB2009627
Supplier Catalog Number: orb2009627
Alternative Catalog Number: BYT-ORB2009627-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: P4HA
P4HA1 Peptide - middle region
Molecular Weight: 56kDa
NCBI: 001136068
UniProt: C9JL12
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: MAKEKDVNKSASDDQSDQKTTPKKKGVAVDYLPERQKYEMLCRGEGIKMT
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with P4HA1 Rabbit Polyclonal Antibody (orb331163). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings