P4HA1 Peptide - middle region

Catalog Number: BYT-ORB2009628
Article Name: P4HA1 Peptide - middle region
Biozol Catalog Number: BYT-ORB2009628
Supplier Catalog Number: orb2009628
Alternative Catalog Number: BYT-ORB2009628-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: P4HA
P4HA1 Peptide - middle region
Molecular Weight: 59kDa
NCBI: 000908
UniProt: P13674
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: TKKLLELDPEHQRANGNLKYFEYIMAKEKDVNKSASDDQSDQKTTPKKKG
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with P4HA1 Rabbit Polyclonal Antibody (orb331162). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings