P2RY2 Peptide - C-terminal region

Product Overview

• Article Name: P2RY2 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2009630
• Supplier Catalog Number: orb2009630
• Alternative Catalog Number: BYT-ORB2009630-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: HP2U, MGC20088, MGC40010, P2RU1, P2U, P2U1, P2UR, P2Y2, P2Y2R

Product Description

P2RY2 Peptide - C-terminal region

Product Properties

• Molecular Weight: 41kDa
• NCBI: 788085
• UniProt: P41231
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: KPPTGPSPATPARRRLGLRRSDRTDMQRIEDVLGSSEDSRRTESTPAGSE

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with P2RY2 Rabbit Polyclonal Antibody (orb585578). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings