P2RXL1 Peptide - N-terminal region

Catalog Number: BYT-ORB2009632
Article Name: P2RXL1 Peptide - N-terminal region
Biozol Catalog Number: BYT-ORB2009632
Supplier Catalog Number: orb2009632
Alternative Catalog Number: BYT-ORB2009632-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: MGC129625, P2RX6, P2X6, P2XM, P2RXL1
P2RXL1 Peptide - N-terminal region
Molecular Weight: 49kDa
NCBI: 005437
UniProt: O15547
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: NWRVGALQRLLQFGIVVYVVGWALLAKKGYQERDLEPQFSIITKLKGVSV
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with P2RXL1 Rabbit Polyclonal Antibody (orb324591). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings