P2rx2 Peptide - middle region

Catalog Number: BYT-ORB2009633
Article Name: P2rx2 Peptide - middle region
Biozol Catalog Number: BYT-ORB2009633
Supplier Catalog Number: orb2009633
Alternative Catalog Number: BYT-ORB2009633-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: MGC129148, MGC129149, P2X2a, P2x2
P2rx2 Peptide - middle region
Molecular Weight: 43kDa
NCBI: 001158306
UniProt: Q812E7
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: EHKVWDVEEYVKPPEGGSVVSIITRIEVTPSQTLGTCPESMRVHSSTCHL
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with P2rx2 Rabbit Polyclonal Antibody (orb575488). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings