OXT Peptide - N-terminal region

Catalog Number: BYT-ORB2009634
Article Name: OXT Peptide - N-terminal region
Biozol Catalog Number: BYT-ORB2009634
Supplier Catalog Number: orb2009634
Alternative Catalog Number: BYT-ORB2009634-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: MGC126890, MGC126892, OT, OT-NPI
OXT Peptide - N-terminal region
Molecular Weight: 9kDa
NCBI: 000906
UniProt: P01178
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: LGLLALTSACYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCA
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with OXT Rabbit Polyclonal Antibody (orb330205). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings