Oxsr1 Peptide - middle region

Product Overview

• Article Name: Oxsr1 Peptide - middle region
• Biozol Catalog Number: BYT-ORB2009635
• Supplier Catalog Number: orb2009635
• Alternative Catalog Number: BYT-ORB2009635-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: 2210022N24Rik, 2810422B09Rik, AI462649, AW209236, Osr1, mKIAA1101

Product Description

Oxsr1 Peptide - middle region

Product Properties

• Molecular Weight: 52kDa
• NCBI: 598746
• UniProt: Q6P9R2
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: RAPTISERSKKVRRVPGSSGRLHKTEDGGWEWSDDEFDEESEEGRAAISQ

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with Oxsr1 Rabbit Polyclonal Antibody (orb330562). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings