Ovca2 Peptide - middle region

Catalog Number: BYT-ORB2009637
Article Name: Ovca2 Peptide - middle region
Biozol Catalog Number: BYT-ORB2009637
Supplier Catalog Number: orb2009637
Alternative Catalog Number: BYT-ORB2009637-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: RGD1564623
Ovca2 Peptide - middle region
Molecular Weight: 24kDa
NCBI: 001102506
UniProt: D4A970
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: LDKLGPFDGLLGFSQGAALAAFVCALGQAGDPRFPLPRFIILVSGFCPRG
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with Ovca2 Rabbit Polyclonal Antibody (orb581203). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings