OTUD6A Peptide - middle region

Catalog Number: BYT-ORB2009638
Article Name: OTUD6A Peptide - middle region
Biozol Catalog Number: BYT-ORB2009638
Supplier Catalog Number: orb2009638
Alternative Catalog Number: BYT-ORB2009638-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: DUBA2, FLJ25831, HSHIN6
OTUD6A Peptide - middle region
Molecular Weight: 32kDa
NCBI: 997203
UniProt: Q7L8S5
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: KMNLENRPPRSSKAHRKRERMESEERERQESIFQAEMSEHLAGFKREEEE
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with OTUD6A Rabbit Polyclonal Antibody (orb331027). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings