OTOS Peptide - N-terminal region

Product Overview

• Article Name: OTOS Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2009642
• Supplier Catalog Number: orb2009642
• Alternative Catalog Number: BYT-ORB2009642-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: OTOSP

Product Description

OTOS Peptide - N-terminal region

Product Properties

• Molecular Weight: 10kDa
• NCBI: 683764
• UniProt: Q8NHW6
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: MQACMVPGLALCLLLGPLAGAKPVQEEGDPYAELPAMPYWPFSTSDFWNY

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with OTOS Rabbit Polyclonal Antibody (orb581868). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings