Otc Peptide - C-terminal region

Product Overview

• Article Name: Otc Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2009643
• Supplier Catalog Number: orb2009643
• Alternative Catalog Number: BYT-ORB2009643-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: AI265390, Sf, spf

Product Description

Otc Peptide - C-terminal region

Product Properties

• Molecular Weight: 40kDa
• NCBI: 032795
• UniProt: P11725
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: YQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSPRSLVFPEAENRKWT

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with Otc Rabbit Polyclonal Antibody (orb578206). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings