OSTalpha Peptide - middle region

Catalog Number: BYT-ORB2009645
Article Name: OSTalpha Peptide - middle region
Biozol Catalog Number: BYT-ORB2009645
Supplier Catalog Number: orb2009645
Alternative Catalog Number: BYT-ORB2009645-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: MGC39807, OSTA, OSTalpha
OSTalpha Peptide - middle region
Molecular Weight: 38kDa
NCBI: 689885
UniProt: Q86UW1
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: LLMLGPFQYAFLKITLTLVGLFLVPDGIYDPADISEGSTALWINTFLGVS
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with OSTalpha Rabbit Polyclonal Antibody (orb325819). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings