OSBPL11 Peptide - C-terminal region

Product Overview

• Article Name: OSBPL11 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2009650
• Supplier Catalog Number: orb2009650
• Alternative Catalog Number: BYT-ORB2009650-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: FLJ13012, FLJ13164, ORP-11, ORP11, OSBP12, TCCCIA00292

Product Description

OSBPL11 Peptide - C-terminal region

Product Properties

• Molecular Weight: 84kDa
• NCBI: 073613
• UniProt: Q9BXB4
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: VDLTKLAVTKKRVRPLEKQDPFESRRLWKNVTDSLRESEIDKATEHKHTL

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with OSBPL11 Rabbit Polyclonal Antibody (orb579531). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings