OSBP Peptide - C-terminal region

Catalog Number: BYT-ORB2009651
Article Name: OSBP Peptide - C-terminal region
Biozol Catalog Number: BYT-ORB2009651
Supplier Catalog Number: orb2009651
Alternative Catalog Number: BYT-ORB2009651-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: OSBP1
OSBP Peptide - C-terminal region
Molecular Weight: 89kDa
NCBI: 002547
UniProt: P22059
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: ALTLNAWESGTAPTDSRLRPDQRLMENGRWDEANAEKQRLEEKQRLSRKK
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with OSBP Rabbit Polyclonal Antibody (orb331090). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings