ORC3L Peptide - C-terminal region

Catalog Number: BYT-ORB2009653
Article Name: ORC3L Peptide - C-terminal region
Biozol Catalog Number: BYT-ORB2009653
Supplier Catalog Number: orb2009653
Alternative Catalog Number: BYT-ORB2009653-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: LAT, LATHEO, ORC3, ORC3L
ORC3L Peptide - C-terminal region
Molecular Weight: 82kDa
NCBI: 862820
UniProt: Q9UBD5
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: VVTAAEKMDANSATSEEMNEIIHARFIRAVSELELLGFIKPTKQKTDHVA
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with ORC3L Rabbit Polyclonal Antibody (orb331176). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings