RIPK2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2081437
Article Name: RIPK2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2081437
Supplier Catalog Number: orb2081437
Alternative Catalog Number: BYT-ORB2081437-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IF, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RIPK2
Conjugation: Biotin
Alternative Names: CCK, RICK, RIP2, CARD3, GIG30, CARDIAK
RIPK2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 61kDa
NCBI: 003812
UniProt: O43353
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT