BIRC7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2081455
Article Name: BIRC7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2081455
Supplier Catalog Number: orb2081455
Alternative Catalog Number: BYT-ORB2081455-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BIRC7
Conjugation: Biotin
Alternative Names: KIAP, LIVIN, MLIAP, RNF50, ML-IAP
BIRC7 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 33kDa
NCBI: 647478
UniProt: Q96CA5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFL