CASP3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2081543
Article Name: CASP3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2081543
Supplier Catalog Number: orb2081543
Alternative Catalog Number: BYT-ORB2081543-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CASP3
Conjugation: HRP
Alternative Names: CPP32, SCA-1, CPP32B
CASP3 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 004337
UniProt: P42574
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIII