ASCL1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2081549
Article Name: ASCL1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2081549
Supplier Catalog Number: orb2081549
Alternative Catalog Number: BYT-ORB2081549-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ASCL1
Conjugation: HRP
Alternative Names: ASH1, HASH1, MASH1, bHLHa46
ASCL1 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 25kDa
NCBI: 004307
UniProt: P50553
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: AGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNW