SIRPA Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2081562
Article Name: SIRPA Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2081562
Supplier Catalog Number: orb2081562
Alternative Catalog Number: BYT-ORB2081562-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SIRPA
Conjugation: FITC
Alternative Names: BIT, MFR, P84, SIRP, MYD-1, SHPS1, CD172A, PTPNS1
SIRPA Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 52kDa
NCBI: 542970
UniProt: B2R6C3
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: QTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK