SIRPA Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2081563
Article Name: SIRPA Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2081563
Supplier Catalog Number: orb2081563
Alternative Catalog Number: BYT-ORB2081563-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SIRPA
Conjugation: Biotin
Alternative Names: BIT, MFR, P84, SIRP, MYD-1, SHPS1, CD172A, PTPNS1
SIRPA Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 52kDa
NCBI: 542970
UniProt: B2R6C3
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: QTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK