NME1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2081564
Article Name: NME1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2081564
Supplier Catalog Number: orb2081564
Alternative Catalog Number: BYT-ORB2081564-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: DOT, IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NME1
Conjugation: HRP
Alternative Names: NB, AWD, NBS, GAAD, NDKA, NM23, NDPKA, NDPK-A, NM23-H1
NME1 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 17kDa
NCBI: 000260
UniProt: P22392
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: ANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEH