NME1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2081565
Article Name: NME1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2081565
Supplier Catalog Number: orb2081565
Alternative Catalog Number: BYT-ORB2081565-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: DOT, IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NME1
Conjugation: FITC
Alternative Names: NB, AWD, NBS, GAAD, NDKA, NM23, NDPKA, NDPK-A, NM23-H1
NME1 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 17kDa
NCBI: 000260
UniProt: P22392
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEH