ADRB2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2081567
Article Name: ADRB2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2081567
Supplier Catalog Number: orb2081567
Alternative Catalog Number: BYT-ORB2081567-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ADRB2
Conjugation: HRP
Alternative Names: BAR, B2AR, ADRBR, ADRB2R, BETA2AR
ADRB2 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 46kDa
NCBI: 000015
UniProt: P07550
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: TGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTN