ADRB2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2081568
Article Name: ADRB2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2081568
Supplier Catalog Number: orb2081568
Alternative Catalog Number: BYT-ORB2081568-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ADRB2
Conjugation: FITC
Alternative Names: BAR, B2AR, ADRBR, ADRB2R, BETA2AR
ADRB2 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 46kDa
NCBI: 000015
UniProt: P07550
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: TGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTN