IGF1R Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2081573
Article Name: IGF1R Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2081573
Supplier Catalog Number: orb2081573
Alternative Catalog Number: BYT-ORB2081573-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IF, IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IGF1R
Conjugation: HRP
Alternative Names: IGFR, CD221, IGFIR, JTK13
IGF1R Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 71kDa
NCBI: 000866
UniProt: P08069
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: DRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC